Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01269.1.g00050.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Protein Properties Length: 168aa    MW: 19241.3 Da    PI: 10.1896
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                    krien + rqv+fskRrng+lKKA+ELSvLCdaeva+++fs++gklye++s  9 KRIENPTSRQVSFSKRRNGLLKKAFELSVLCDAEVALVVFSTRGKLYEFAS 59
                                    79***********************************************86 PP

                           K-box  34 eqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                                     + R+llGe Le++s++eL++Le +Leksl+ +R +K++ll eq+++l++ke  l+++n++Lr+k +  59 SARKLLGERLEECSIEELHSLEVKLEKSLRIVRGRKTQLLEEQVRKLKEKEMTLRKNNEDLREKCK 124
                                     57*************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.104161IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-37160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.12E-27361IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-30323IPR002100Transcription factor, MADS-box
CDDcd002653.40E-34359No hitNo description
PfamPF003197.4E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-303859IPR002100Transcription factor, MADS-box
PROSITE profilePS512979.95139129IPR002487Transcription factor, K-box
PfamPF014868.2E-2059124IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A5e-17360259Myocyte-specific enhancer factor 2A
3kov_B5e-17360259Myocyte-specific enhancer factor 2A
3kov_I5e-17360259Myocyte-specific enhancer factor 2A
3kov_J5e-17360259Myocyte-specific enhancer factor 2A
3mu6_A4e-17360259Myocyte-specific enhancer factor 2A
3mu6_B4e-17360259Myocyte-specific enhancer factor 2A
3mu6_C4e-17360259Myocyte-specific enhancer factor 2A
3mu6_D4e-17360259Myocyte-specific enhancer factor 2A
3p57_A5e-17360259Myocyte-specific enhancer factor 2A
3p57_B5e-17360259Myocyte-specific enhancer factor 2A
3p57_C5e-17360259Myocyte-specific enhancer factor 2A
3p57_D5e-17360259Myocyte-specific enhancer factor 2A
3p57_I5e-17360259Myocyte-specific enhancer factor 2A
3p57_J5e-17360259Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985919.14e-81PREDICTED: MADS-box transcription factor 50 isoform X2
RefseqXP_004985920.14e-81PREDICTED: MADS-box transcription factor 50 isoform X2
RefseqXP_012698462.14e-81PREDICTED: MADS-box transcription factor 50 isoform X2
SwissprotQ9XJ602e-77MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLQ9FR858e-79Q9FR85_MAIZE; M5 protein
STRINGGRMZM2G171365_P012e-78(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number